PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G180300.1.p
Common NameGLYMA_07G180300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 232aa    MW: 26511.9 Da    PI: 5.0572
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G180300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB100.11.8e-3124113695
                NF-YB   6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                            +Pi+n+++im ++l +n ++s d+ +++q+ ++++i fvt +a d+cq e rk +n++dllwa+ +lGf+dyvepl++++++yr++eg
  Glyma.07G180300.1.p  24 SKMPITNMMKIMSQILLNNVQVSYDTMDMIQQSATKYINFVTRKAKDRCQSECRKIMNAEDLLWAIEELGFNDYVEPLTTFIQRYRNIEG 113
                          579*************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-2823113IPR009072Histone-fold
PfamPF008086.0E-132589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471138.18E-2225113IPR009072Histone-fold
PRINTSPR006159.6E-105371No hitNo description
PRINTSPR006159.6E-107290No hitNo description
PRINTSPR006159.6E-1091109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MAISLPINSN NGDRVPNLVL RDKSKMPITN MMKIMSQILL NNVQVSYDTM DMIQQSATKY  60
INFVTRKAKD RCQSECRKIM NAEDLLWAIE ELGFNDYVEP LTTFIQRYRN IEGVDLFTTH  120
KEPISHIENH GPSLGPEPNL MSTLEMLHPP QPPQVNSSQP KFSIIPNTNL EMLYPNEMSS  180
TKIHLVLVVQ MMFSTTLMFL LSSIMINIEM IIEEIQLQLT IMAMDYDIGN K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A6e-1926109992NF-YB
4awl_B7e-19261091093NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A7e-19261091093NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014628426.11e-67PREDICTED: nuclear transcription factor Y subunit beta-like
TrEMBLA0A0B2SKU81e-170A0A0B2SKU8_GLYSO; Nuclear transcription factor Y subunit B-9
TrEMBLK7L2H01e-170K7L2H0_SOYBN; Uncharacterized protein
STRINGGLYMA07G29695.11e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.16e-31NF-YB family protein